PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1056_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 379aa    MW: 43384.4 Da    PI: 9.8781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1056_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-16453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd +l  +vkq+G++ W++I+++mg  ++R +k+c +rw +yl
    Neem_1056_f_3  4 RQRWQPEEDAILRAYVKQYGPKEWNLISQRMGktLHRDPKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding35.32.7e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l + + +++G++ Wk+Ia++++ gRt+k +  +w  +
    Neem_1056_f_3  59 KGSLTPEEQSLVISLQAKYGNK-WKKIASEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.103157IPR017930Myb domain
SMARTSM007173.3E-14355IPR001005SANT/Myb domain
SuperFamilySSF466891.25E-22498IPR009057Homeodomain-like
CDDcd001672.10E-9653No hitNo description
Gene3DG3DSA:1.10.10.603.9E-21660IPR009057Homeodomain-like
PfamPF139213.4E-16769No hitNo description
SMARTSM007174.7E-1058106IPR001005SANT/Myb domain
PROSITE profilePS5129417.76858108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-1561108IPR009057Homeodomain-like
CDDcd001671.77E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MKERQRWQPE EDAILRAYVK QYGPKEWNLI SQRMGKTLHR DPKSCLERWK NYLKPGIKKG  60
SLTPEEQSLV ISLQAKYGNK WKKIASEVPG RTAKRLGKWW EVFKEKQLKQ LHKEKLQRRE  120
YSDQEGNIQV GSALASTSSP ERVAQGRYDH ILETFAEKYV QPKLFALQAL NLNPIMPNIS  180
LPDPEPVLSL GSGPSSTSTN GIPLWMNNHT SPSLSSSNSS TTTASPSVSL SLSPSEPPGL  240
DPGDITRFMP GQQMGTLVQY CKELEEGRQS WMQHKKEATW RLSRLEQQLE SEKARKRREK  300
MEEIETKIRA LREEEMAFLG RIDSEYREQL SALQRDAESK EAKLMESWCN KHVKLLKLVE  360
QIGVQSSSHG GFSIPKDMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A5e-15111169113MYB3
3zqc_D5e-15111169113MYB3
3zqc_G5e-15111169113MYB3
3zqc_J5e-15111169113MYB3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1294299RKRREK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430817.10.0hypothetical protein CICLE_v10011915mg
SwissprotO809311e-104AS1_ARATH; Transcription factor AS1
TrEMBLV4STI90.0V4STI9_9R
STRINGVIT_14s0083g00120.t011e-175(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61862740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.13e-59MYB family protein